missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Ribosomal Protein L17 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Ribosomal Protein L17 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Ribosomal Protein L17 Polyclonal specifically detects Ribosomal Protein L17 in Mouse samples. It is validated for Western Blot.Specifications
| Ribosomal Protein L17 | |
| Polyclonal | |
| Rabbit | |
| Q9CPR4 | |
| 6139 | |
| Synthetic peptides corresponding to the N terminal of Rpl17. Immunizing peptide sequence SLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDVTLK. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ18762,60S ribosomal protein L23, FLJ92089, gene encoding putative NFkB activating protein, MGC117162, PD-1, ribosomal protein L17, rpL23, RPL23,60S ribosomal protein L17 | |
| RPL17 | |
| IgG | |
| 20 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title