missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RG9MTD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | RG9MTD1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
RG9MTD1 Polyclonal specifically detects RG9MTD1 in Human samples. It is validated for Western Blot.Specifications
| RG9MTD1 | |
| Polyclonal | |
| Rabbit | |
| Q7L0Y3 | |
| 54931 | |
| Synthetic peptides corresponding to RG9MTD1 (RNA (guanine-9-) methyltransferase domain containing 1) The peptide sequence was selected from the middle region of RG9MTD1. Peptide sequence MKRKELQNTVSQLLESEGWNRRNVDPFHIYFCNLKIDGALHRELVKRYQE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 2.1.1, EC 2.1.1.-, EC 2.1.1.36, FLJ20432, HBV pre-S2 trans-regulated protein 2, Mitochondrial RNase P protein 1, MRPP1mitochondrial ribonuclease P protein 1, NY-REN-49 antigen, Renal carcinoma antigen NY-REN-49, RNA (guanine-9-) methyltransferase domain containing 1, RNA (guanine-9-)-methyltransferase domain-containing protein 1 | |
| TRMT10C | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title