missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RFPL4B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | RFPL4B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
RFPL4B Polyclonal specifically detects RFPL4B in Human samples. It is validated for Western Blot.Specifications
| RFPL4B | |
| Polyclonal | |
| Rabbit | |
| Zinc Finger | |
| Q6ZWI9 | |
| 442247 | |
| Synthetic peptides corresponding to RFPL4B(ret finger protein-like 4B) The peptide sequence was selected from the middle region of RFPL4B. Peptide sequence EVGEVKSWSLGVCKEPADRKSNDLFPEHGFWISMKAGAIHANTHLERIPA. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Human | |
| ret finger protein-like 4B, RNF211RING finger protein 211 | |
| RFPL4B | |
| IgG | |
| 30 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title