missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RELM beta Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | RELM beta |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Pris | Kvantitet och tillgänglighet | |||||
|
18468501
|
Novus Biologicals
NBP2-13218-25ul |
25ul |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18754963
|
Novus Biologicals
NBP2-13218 |
0.1 mL |
£513.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beskrivning
RELM beta Polyclonal specifically detects RELM beta in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifikationer
| RELM beta | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| C/EBP-epsilon regulated myeloid-specific secreted cysteine-rich proteinprecursor 2, CCRG, Colon and small intestine-specific cysteine-rich protein, Colon carcinoma-related gene protein, cysteine-rich secreted A12-alpha-like protein 1, Cysteine-rich secreted protein A12-alpha-like 1, Cysteine-rich secreted protein FIZZ2, FIZZ1, FIZZ2RELM-beta, found in inflammatory zone 1, HXCP2XCP2, RELMb, RELMbeta, resistin like beta, resistin-like beta, RETNL2 | |
| RETNLB | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Cancer | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 84666 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: LDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel