RELM beta Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-13218-25ul

Product Code. 18468501

Description

RELM beta Polyclonal specifically detects RELM beta in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RELM beta
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: C/EBP-epsilon regulated myeloid-specific secreted cysteine-rich proteinprecursor 2, CCRG, Colon and small intestine-specific cysteine-rich protein, Colon carcinoma-related gene protein, cysteine-rich secreted A12-alpha-like protein 1, Cysteine-rich secreted protein A12-alpha-like 1, Cysteine-rich secreted protein FIZZ2, FIZZ1, FIZZ2RELM-beta, found in inflammatory zone 1, HXCP2XCP2, RELMb, RELMbeta, resistin like beta, resistin-like beta, RETNL2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: RETNLB
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: LDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT
• Quantity: 25ul
• Research Discipline: Cancer
• Gene ID (Entrez): 84666
• Target Species: Human
• Isotype: IgG

For Research Use Only