missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Relaxin R1/LGR7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £410.00
Specifications
| Antigen | Relaxin R1/LGR7 |
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200-1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18445051
|
Novus Biologicals
NBP1-89585-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18292808
|
Novus Biologicals
NBP1-89585 |
0.1 mL |
£410.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Relaxin R1/LGR7 Polyclonal specifically detects Relaxin R1/LGR7 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Relaxin R1/LGR7 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| leucine-rich repeat-containing G protein-coupled receptor 7, Leucine-rich repeat-containing G-protein coupled receptor 7, LGR7.1, LGR7.10, LGR7LGR7.2, MGC138347, MGC142177, Relaxin family peptide receptor 1, relaxin receptor 1, relaxin/insulin-like family peptide receptor 1, RXFPR1 | |
| RXFP1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200-1:500 | |
| Polyclonal | |
| Rabbit | |
| GPCR | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 59350 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:PFKEMIHRFWYNYRQRKSMDSKGQKTYAPSFIWVEMWPLQEMPPELMKPDLFTYPCEMSLISQSTRLNS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title