Relaxin R1/LGR7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-89585-25ul

Product Code. 18445051

Description

Relaxin R1/LGR7 Polyclonal specifically detects Relaxin R1/LGR7 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Relaxin R1/LGR7
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200-1:500
• Gene Alias: leucine-rich repeat-containing G protein-coupled receptor 7, Leucine-rich repeat-containing G-protein coupled receptor 7, LGR7.1, LGR7.10, LGR7LGR7.2, MGC138347, MGC142177, Relaxin family peptide receptor 1, relaxin receptor 1, relaxin/insulin-like family peptide receptor 1, RXFPR1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: RXFP1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:PFKEMIHRFWYNYRQRKSMDSKGQKTYAPSFIWVEMWPLQEMPPELMKPDLFTYPCEMSLISQSTRLNS
• Quantity: 25 μL
• Research Discipline: GPCR
• Gene ID (Entrez): 59350
• Target Species: Human
• Isotype: IgG

For Research Use Only