missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant other DnaK Protein

A cDNA sequence encoding the DnaK was constructed and used to recombinantly synthesize the protein.

£98.39 - £1989.41

Specifications

Name DnaK Protein
Product Type Recombinant Protein
Protein Tag Untagged
Host Species E. coli
Cross Reactivity Other
View More Specs

Products 3
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
15948028
View Documents Promotion Details
enQuireBio™
QP11682-10UG
10 μg
£98.39
10µg
View alternative products
Save Up to 
»
Estimated Shipment: 24-02-2022
Please to purchase this item. Need a web account? Register with us today!
15968028
View Documents Promotion Details
enQuireBio™
QP11682-50UG
50 μg
£151.37
50µg
View alternative products
Save Up to 
»
Estimated Shipment: 24-02-2022
Please to purchase this item. Need a web account? Register with us today!
15958028
View Documents Promotion Details
enQuireBio™
QP11682-1MG
1 mg
£1989.41
1mg
View alternative products
Save Up to 
»
Estimated Shipment: 24-02-2022
Please to purchase this item. Need a web account? Register with us today!
Description

Description

Specifications

Specifications

DnaK Protein
Untagged
Other
Greater than 95.0% as determined by SDS-PAGE.
Recombinant Protein
E. coli
MGKIIGIDLG TTNSCVAIMD GTTPRVLENA EGDRTTPSII AYTQDGETLV GQPAKRQAVTNPQNTLFAIK RLIGRRFQDE EVQRDVSIMP FKIIAADNGD AWVEVKGQKM APPQISAEVLKKMKKTAEDY LGEPVTEAVI TVPAYFNDAQ RQATKDAGRI AGLEVKRIINEPTAAALAYGLDKGTGNRTI AVYDLGGGTFDISIIEIDEV DGEKTFEVLA TNGDTHLGGE DFDSRLINYLVEEFKKDQGI DLRNDPLAMQ RLKEAAEKAK IELSSAQQTD VNLPYITADA TGPKHMNIKVTRAKLESLVE DLVNRSIEPL KVALQDAGLS VSDIDDVILV GGQTRMPMVQ KKVAEFFGKEPRKDVNPDEA VAIGAAVQGG VLTGDVKDVL LLDVTPLSLG IETMGGVMTT LIAKNTTIPTKHSQVFSTAE DNQSAVTIHV LQGERKRAAD NKSLGQFNLD GINPAPRGMPQIEVTFDIDADGILHVSAKD KNSGKEQKITIKASSGLNED EIQKMVRDAE ANAEADRKFE ELVQTRNQGDHLLHSTRKQV EEAGDKLPAD DKTAIESALT ALETALKGED KAAIEAKMQE LAQVSQKLMEIAQQQHAQQQ TAGADASANN AKDDDVVDAE FEEVKDKK
SDS
Product Certifications