missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Mouse IL17E Protein

A cDNA sequence encoding the IL17E was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP10725-1mg

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15944978

  • £2978.71 / 1mg
Estimated Shipment: 10-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Specifications

Specifications

140806
Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Research Use Only
Il25
Recombinant Protein
E. coli
VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA
IL17E Protein
1 mg
< 1.0 EU per ug protein as determined by the LAL method.
The activity is determined by the dose-dependent production of IL-8 by human PBMCs and is 322-488ng/ml.
Mouse
Untagged
IL17E was lyophilized from a concentrated (1 mg/ml) solution containing no additives.
Videos
SDS
Documents
Certificates
Special Offers

Special Offers