missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Mouse IL17E Protein
A cDNA sequence encoding the IL17E was constructed and used to recombinantly synthesize the protein.
£99.15 - £2975.00
Specifications
| Gene ID (Entrez) | 140806 |
|---|---|
| Name | IL17E Protein |
| Regulatory Status | Research Use Only |
| Endotoxin Concentration | < 1.0 EU per ug protein as determined by the LAL method. |
| Gene Symbol | Il25 |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
15964978
|
enQuireBio™
QP10725-5UG |
5 μg |
£99.15
5µg |
Estimated Shipment: 05-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
|
15954978
|
enQuireBio™
QP10725-25UG |
25 μg |
£155.00
25µg |
Estimated Shipment: 05-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
|
15944978
|
enQuireBio™
QP10725-1MG |
1 mg |
£2975.00
1mg |
Estimated Shipment: 05-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Specifications
| 140806 | |
| Research Use Only | |
| Il25 | |
| Recombinant Protein | |
| E. coli | |
| VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA | |
| Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
| IL17E Protein | |
| < 1.0 EU per ug protein as determined by the LAL method. | |
| The activity is determined by the dose-dependent production of IL-8 by human PBMCs and is 322-488ng/ml. | |
| Mouse | |
| Untagged | |
| IL17E was lyophilized from a concentrated (1 mg/ml) solution containing no additives. |