missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Hepatitis C HCV NS4 a+b Protein

A cDNA sequence encoding the HCV NS4 a+b was constructed and used to recombinantly synthesize the protein.

£280.03 - £1654.24

Specifications

Name Hepatitis C HCV NS4 a+b Protein
Product Type Recombinant Protein
Protein Tag Biotin
Host Species E. coli
Cross Reactivity Hepatitis C
View More Specs

Products 3
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
15939608
View Documents Promotion Details
enQuireBio™
QP12178-B-100UG
100 μg
£280.03
100µg
View alternative products
Save Up to 
»
Estimated Shipment: 24-02-2022
Please to purchase this item. Need a web account? Register with us today!
15959608
View Documents Promotion Details
enQuireBio™
QP12178-B-500UG
500 μg
£992.54
500µg
View alternative products
Save Up to 
»
Estimated Shipment: 24-02-2022
Please to purchase this item. Need a web account? Register with us today!
15949608
View Documents Promotion Details
enQuireBio™
QP12178-B-1MG
1 mg
£1654.24
1mg
View alternative products
Save Up to 
»
Estimated Shipment: 24-02-2022
Please to purchase this item. Need a web account? Register with us today!
Description

Description

Specifications

Specifications

Hepatitis C HCV NS4 a+b Protein
Biotin
Hepatitis C
HCV NS4 a+b Biotin protein is >95% pure as determined by 10% PAGE (coomassie staining).
Recombinant Protein
E. coli
1658 TWVLVGGVLAALAAYCLSTGCVVIVGRVVLSGKPAIIPDREVLYREFDEMEECSQHLPYIEQGMMLAEQFKQKALGLLQTASRQAEVIAPAVQTNWQKLETFWAKHMWNFISGIQYLAGLSTLPGNPAIASLMAFTAAVTSPLTTSQTLLFNILGGWVAAQLAAPGAATAFVGAGLAGAAIGSVGLGKVLIDILAGYGAGVAGAL 1863
SDS
Product Certifications