missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Hepatitis C HCV NS4 a+b Protein
A cDNA sequence encoding the HCV NS4 a+b was constructed and used to recombinantly synthesize the protein.
Brand: enQuireBio™ QP12178-B-1mg
Additional Details : Weight : 0.01000kg
Specifications
Hepatitis C HCV NS4 a+b Protein | |
Research Use Only | |
Recombinant Protein | |
E. coli | |
1658 TWVLVGGVLAALAAYCLSTGCVVIVGRVVLSGKPAIIPDREVLYREFDEMEECSQHLPYIEQGMMLAEQFKQKALGLLQTASRQAEVIAPAVQTNWQKLETFWAKHMWNFISGIQYLAGLSTLPGNPAIASLMAFTAAVTSPLTTSQTLLFNILGGWVAAQLAAPGAATAFVGAGLAGAAIGSVGLGKVLIDILAGYGAGVAGAL 1863 | |
HCV NS4 a+b Biotin protein is >95% pure as determined by 10% PAGE (coomassie staining). |
1 mg | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
Hepatitis C | |
Biotin | |
(1 mg/ml) 20mM Tris-HCl pH 8 and 8M urea. |