enQuireBio™ Recombinant Hepatitis C HCV NS4 a+b Protein

A cDNA sequence encoding the HCV NS4 a+b was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP12178-B-1mg

Product Code. 15949608

Specifications

• Name: Hepatitis C HCV NS4 a+b Protein
• Regulatory Status: Research Use Only
• Product Type: Recombinant Protein
• Species: E. coli
• Sequence: 1658 TWVLVGGVLAALAAYCLSTGCVVIVGRVVLSGKPAIIPDREVLYREFDEMEECSQHLPYIEQGMMLAEQFKQKALGLLQTASRQAEVIAPAVQTNWQKLETFWAKHMWNFISGIQYLAGLSTLPGNPAIASLMAFTAAVTSPLTTSQTLLFNILGGWVAAQLAAPGAATAFVGAGLAGAAIGSVGLGKVLIDILAGYGAGVAGAL 1863
• Purity or Quality Grade: HCV NS4 a+b Biotin protein is >95% pure as determined by 10% PAGE (coomassie staining).

• Quantity: 1 mg
• Endotoxin Concentration: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
• Cross Reactivity: Hepatitis C
• Protein Tag: Biotin
• Buffer: (1 mg/ml) 20mM Tris-HCl pH 8 and 8M urea.