missing translation for 'onlineSavingsMsg'
Learn More
Learn More
REC8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£294.00 - £437.00
Specifications
| Antigen | REC8 |
|---|---|
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18471131
|
Novus Biologicals
NBP1-87145-25ul |
25 μL |
£294.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18059075
|
Novus Biologicals
NBP1-87145 |
0.1 mL |
£437.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
REC8 Polyclonal specifically detects REC8 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| REC8 | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Cohesin Rec8p, cohesion rec8p, HR21spB, meiotic recombination and sister chromatid cohesion phosphoprotein of therad21p family, meiotic recombination protein REC8 homolog, meiotic recombination protein REC8-like 1, MGC950, REC8 homolog (yeast), REC8L1human homolog of rad21, S. pombe, REC8-like 1, REC8-like 1 (yeast), Rec8p, recombination and sister chromatid cohesion protein homolog | |
| REC8 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication, Neuroscience | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 9985 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:PSPFDIPQIRHLLEAAIPERVEEIPPEVPTEPREPERIPVTVLPPEAITILEAEPIRMLEIEGERELPEVSRRELDLLI | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title