missing translation for 'onlineSavingsMsg'
Learn More
Learn More
REC8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-87145-25ul
This item is not returnable.
View return policy
Description
REC8 Polyclonal specifically detects REC8 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| REC8 | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Cohesin Rec8p, cohesion rec8p, HR21spB, meiotic recombination and sister chromatid cohesion phosphoprotein of therad21p family, meiotic recombination protein REC8 homolog, meiotic recombination protein REC8-like 1, MGC950, REC8 homolog (yeast), REC8L1human homolog of rad21, S. pombe, REC8-like 1, REC8-like 1 (yeast), Rec8p, recombination and sister chromatid cohesion protein homolog | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| REC8 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:PSPFDIPQIRHLLEAAIPERVEEIPPEVPTEPREPERIPVTVLPPEAITILEAEPIRMLEIEGERELPEVSRRELDLLI | |
| 25 μL | |
| Cell Cycle and Replication, Neuroscience | |
| 9985 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Partager une correction de contenu