missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RDH16 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | RDH16 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
RDH16 Polyclonal specifically detects RDH16 in Human samples. It is validated for Western Blot.Specifications
| RDH16 | |
| Polyclonal | |
| Rabbit | |
| O75452 | |
| RDH16 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 8608 | |
| Synthetic peptides corresponding to RDH16(retinol dehydrogenase 16 (all-trans)) The peptide sequence was selected from the N terminal of RDH16. Peptide sequence WLYLAVFVGLYYLLHWYRERQVLSHLRDKYVFITGCDSGFGKLLARQLDA. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title