missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RDH16 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-58060
This item is not returnable.
View return policy
Description
RDH16 Polyclonal specifically detects RDH16 in Human samples. It is validated for Western Blot.
Specifications
| RDH16 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| EC 1.1, EC 1.1.1, EC 1.1.1.105, Microsomal NAD+-dependent retinol dehydrogenase 4, retinol dehydrogenase 16, retinol dehydrogenase 16 (all-trans and 13-cis), retinol dehydrogenase 16 (all-trans), RODH4, RODH-4, SDR9C8, short chain dehydrogenase/reductase family 9C, member 8, Sterol/retinol dehydrogenase | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 8608 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| O75452 | |
| RDH16 | |
| Synthetic peptides corresponding to RDH16(retinol dehydrogenase 16 (all-trans)) The peptide sequence was selected from the N terminal of RDH16. Peptide sequence WLYLAVFVGLYYLLHWYRERQVLSHLRDKYVFITGCDSGFGKLLARQLDA. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Human: 100%; Pig: 92%; Bovine: 85%; Canine: 85%; Mouse: 84%. | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction