missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RBM46 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | RBM46 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
RBM46 Polyclonal specifically detects RBM46 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| RBM46 | |
| Polyclonal | |
| Rabbit | |
| NP_659416 | |
| 166863 | |
| Synthetic peptide directed towards the N terminal of human MGC27016. Peptide sequence LNNYEIRPGKFIGVCVSLDNCRLFIGAIPKEKKKEEILDEMKKVTEGVVD. | |
| Primary |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Cancer/testis antigen 68, CT68MGC27016, probable RNA-binding protein 46, RNA binding motif protein 46, RNA-binding motif protein 46 | |
| RBM46 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title