missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RBM4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | RBM4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
RBM4 Polyclonal specifically detects RBM4 in Human samples. It is validated for Western Blot.Specifications
| RBM4 | |
| Polyclonal | |
| Rabbit | |
| Q96LT9 | |
| 5936 | |
| Synthetic peptides corresponding to RBM4(RNA binding motif protein 4) The peptide sequence was selected from the middle region of RBM4. Peptide sequence TAPGMGDQSGCYRCGKEGHWSKECPIDRSGRVADLTEQYNEQYGAVRTPY. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DKFZp547K0918, FLJ36727, hLark, Lark homolog, MGC75138, RBM4. LARK, RBM4ALARK, RNA binding motif protein 4, RNA-binding motif protein 4, RNA-binding motif protein 4a, RNA-binding protein 4, transcriptional coactivator CoAZ, ZCCHC21, ZCRB3A, zinc finger CCHC-type and RNA binding motif 3A | |
| RBM4 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title