missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RBM4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-57385
This item is not returnable.
View return policy
Description
RBM4 Polyclonal specifically detects RBM4 in Human samples. It is validated for Western Blot.
Specifications
| RBM4 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| DKFZp547K0918, FLJ36727, hLark, Lark homolog, MGC75138, RBM4. LARK, RBM4ALARK, RNA binding motif protein 4, RNA-binding motif protein 4, RNA-binding motif protein 4a, RNA-binding protein 4, transcriptional coactivator CoAZ, ZCCHC21, ZCRB3A, zinc finger CCHC-type and RNA binding motif 3A | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 5936 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q96LT9 | |
| RBM4 | |
| Synthetic peptides corresponding to RBM4(RNA binding motif protein 4) The peptide sequence was selected from the middle region of RBM4. Peptide sequence TAPGMGDQSGCYRCGKEGHWSKECPIDRSGRVADLTEQYNEQYGAVRTPY. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Guinea pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Bovine: 92%; Canine: 92%; Goat: 92%; Equine: 92%; Pig: 92%; Rabbit: 85%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction