missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RASEF Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£359.00
Specifications
| Antigen | RASEF |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
RASEF Polyclonal specifically detects RASEF in Human samples. It is validated for Western Blot.Specifications
| RASEF | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS buffer, 2% sucrose | |
| 158158 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| FLJ31614, RAB45, RAB45, member RAS oncogene family, RAS and EF hand domain containing, RAS and EF-hand domain containing, ras and EF-hand domain-containing protein, Ras-related protein Rab-45 | |
| The immunogen is a synthetic peptide directed towards the N-terminal region of Human RASEF (NP_689786). Peptide sequence AQDKAAMQLSELEEEMDQRIQAAEHKTRKDEKRKAEEALSDLRRQYETEV | |
| Affinity purified |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto