RASEF Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-09528-100UL

Product Code. 18338194

Description

RASEF Polyclonal specifically detects RASEF in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RASEF
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: FLJ31614, RAB45, RAB45, member RAS oncogene family, RAS and EF hand domain containing, RAS and EF-hand domain containing, ras and EF-hand domain-containing protein, Ras-related protein Rab-45
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human RASEF (NP_689786). Peptide sequence AQDKAAMQLSELEEEMDQRIQAAEHKTRKDEKRKAEEALSDLRRQYETEV
• Quantity: 100 μg
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 158158
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified