missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RAB22A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | RAB22A |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
RAB22A Polyclonal specifically detects RAB22A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).Specifications
| RAB22A | |
| Unconjugated | |
| RUO | |
| P35285 | |
| 57403 | |
| Synthetic peptides corresponding to RAB22A(RAB22A, member RAS oncogene family) The peptide sequence was selected from the middle region of RAB22A. Peptide sequence IFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRS. | |
| Primary |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| GTP-binding protein RAB22A, MGC16770, Rab-22, RAB22, RAB22A, member RAS oncogene family, ras-related protein Rab-22A | |
| RAB22A | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title