RAB22A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-56889

Product Code. 18289614

Description

RAB22A Polyclonal specifically detects RAB22A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).

Specifications

• Antigen: RAB22A
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: GTP-binding protein RAB22A, MGC16770, Rab-22, RAB22, RAB22A, member RAS oncogene family, ras-related protein Rab-22A
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Gene Accession No.: P35285
• Gene Symbols: RAB22A
• Immunogen: Synthetic peptides corresponding to RAB22A(RAB22A, member RAS oncogene family) The peptide sequence was selected from the middle region of RAB22A. Peptide sequence IFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRS.
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 57403
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.