missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PTPLAD2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | PTPLAD2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PTPLAD2 Polyclonal specifically detects PTPLAD2 in Human samples. It is validated for Western Blot.Specifications
| PTPLAD2 | |
| Polyclonal | |
| Rabbit | |
| Q5VWC8 | |
| 401494 | |
| Synthetic peptides corresponding to PTPLAD2(protein tyrosine phosphatase-like A domain containing 2) The peptide sequence was selected from the middle region of PTPLAD2. Peptide sequence LLHIYVGIESNHLLPRFLQLTERIIILFVVITSQEEVQEKYVVCVLFVFW. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DKFZp686F01145, DKFZp686G24132, EC 4.2.1.-, Em:AL662879.1, HACD4, protein tyrosine phosphatase-like A domain containing 2, Protein tyrosine phosphatase-like protein PTPLAD2,3-hydroxyacyl-CoA dehydratase 4, Protein-tyrosine phosphatase-like A domain-containing protein 2 | |
| PTPLAD2 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title