PTPLAD2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-59414

Product Code. 18264993

Description

PTPLAD2 Polyclonal specifically detects PTPLAD2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PTPLAD2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp686F01145, DKFZp686G24132, EC 4.2.1.-, Em:AL662879.1, HACD4, protein tyrosine phosphatase-like A domain containing 2, Protein tyrosine phosphatase-like protein PTPLAD2,3-hydroxyacyl-CoA dehydratase 4, Protein-tyrosine phosphatase-like A domain-containing protein 2
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 401494
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q5VWC8
• Gene Symbols: PTPLAD2
• Immunogen: Synthetic peptides corresponding to PTPLAD2(protein tyrosine phosphatase-like A domain containing 2) The peptide sequence was selected from the middle region of PTPLAD2. Peptide sequence LLHIYVGIESNHLLPRFLQLTERIIILFVVITSQEEVQEKYVVCVLFVFW.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 92%; Mouse: 92%; Rat: 92%; Chicken: 85%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG