missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PTP gamma/PTPRG Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £484.00
Specifications
| Antigen | PTP gamma/PTPRG |
|---|---|
| Dilution | Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18217114
|
Novus Biologicals
NBP2-57477 |
100 μL |
£484.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18605168
|
Novus Biologicals
NBP2-57477-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PTP gamma/PTPRG Polyclonal specifically detects PTP gamma/PTPRG in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| PTP gamma/PTPRG | |
| Polyclonal | |
| Rabbit | |
| Human | |
| EC 3.1.3.48, H_RG317H01.1, HPTPG, protein tyrosine phosphatase, receptor type, G, protein tyrosine phosphatase, receptor type, gamma polypeptide, Protein-tyrosine phosphatase gamma, PTPGprotein tyrosine phosphatase gamma, receptor type protein tyrosine phosphatase gamma, receptor tyrosine phosphatase gamma, receptor-type protein phosphatase gamma, receptor-type tyrosine-protein phosphatase gamma, RPTPG, R-PTP-GAMMA | |
| PTPRG | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 5793 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ALHENRHGSAVQIRRRKASGDPYWAYSGAYGPEHWVTSSVSCGGRHQSPIDILDQYARVGEEYQELQLDGFDNESSNKTWMKNTGKTVAILLKDDYFVS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title