PTP gamma/PTPRG Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-57477

Product Code. 18217114

Description

PTP gamma/PTPRG Polyclonal specifically detects PTP gamma/PTPRG in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PTP gamma/PTPRG
• Classification: Polyclonal
• Dilution: Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: EC 3.1.3.48, H_RG317H01.1, HPTPG, protein tyrosine phosphatase, receptor type, G, protein tyrosine phosphatase, receptor type, gamma polypeptide, Protein-tyrosine phosphatase gamma, PTPGprotein tyrosine phosphatase gamma, receptor type protein tyrosine phosphatase gamma, receptor tyrosine phosphatase gamma, receptor-type protein phosphatase gamma, receptor-type tyrosine-protein phosphatase gamma, RPTPG, R-PTP-GAMMA
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5793
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: PTPRG
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ALHENRHGSAVQIRRRKASGDPYWAYSGAYGPEHWVTSSVSCGGRHQSPIDILDQYARVGEEYQELQLDGFDNESSNKTWMKNTGKTVAILLKDDYFVS
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only