missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PSGL-1/CD162 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£343.00 - £557.00
Specifications
| Antigen | PSGL-1/CD162 |
|---|---|
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18362083
|
Novus Biologicals
NBP3-16974-25UL |
25 μg |
£343.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18313036
|
Novus Biologicals
NBP3-16974-100UL |
100 μg |
£557.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PSGL-1/CD162 Polyclonal antibody specifically detects PSGL-1/CD162 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| PSGL-1/CD162 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cholesterol Metabolism, Immunology, Lipid and Metabolism | |
| PBS, pH 7.2, 40% glycerol | |
| 6404 | |
| IgG | |
| Affinity purified |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| CD162, CD162 antigen, P-selectin glycoprotein ligand 1, PSGL1, PSGL-1cutaneous lymphocyte-associated associated antigen, selectin P ligandCLA | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: LSRKGHMYPVRNYSPTEMVCISSLLPDGGEGPSATANGGLSKAKSPGLTPEPREDREGDDLTLHSFLP | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title