missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PSGL-1/CD162 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-16974-100UL
This item is not returnable.
View return policy
Description
PSGL-1/CD162 Polyclonal antibody specifically detects PSGL-1/CD162 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| PSGL-1/CD162 | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| CD162, CD162 antigen, P-selectin glycoprotein ligand 1, PSGL1, PSGL-1cutaneous lymphocyte-associated associated antigen, selectin P ligandCLA | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: LSRKGHMYPVRNYSPTEMVCISSLLPDGGEGPSATANGGLSKAKSPGLTPEPREDREGDDLTLHSFLP | |
| 100 μg | |
| Cholesterol Metabolism, Immunology, Lipid and Metabolism | |
| 6404 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction