missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PRPF6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£361.00
Specifications
| Antigen | PRPF6 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
PRPF6 Polyclonal specifically detects PRPF6 in Human samples. It is validated for Western Blot.Specifications
| PRPF6 | |
| Polyclonal | |
| Purified | |
| RUO | |
| 24148 | |
| Synthetic peptides corresponding to PRPF6(PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of PRPF6. Peptide sequence PGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| androgen receptor N-terminal domain transactivating protein-1, ANT-1, bB152O15.1, C20orf14, chromosome 20 open reading frame 14, hPrp6, p102 U5 small nuclear ribonucleoprotein particle-binding protein, pre-mRNA-processing factor 6, Prp6, PRP6 homolog, PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae), PRP6 pre-mRNA processing factor 6 homolog (yeast), putative mitochondrial outer membrane protein import receptor, TOM, U5 snRNP-associated 102 kDa protein, U5-102 kDa protein, U5-102K | |
| PRPF6 | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title