PRPF6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-57544

Product Code. 18276393

Description

PRPF6 Polyclonal specifically detects PRPF6 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PRPF6
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: PRPF6
• Immunogen: Synthetic peptides corresponding to PRPF6(PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of PRPF6. Peptide sequence PGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEE.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Xenopus: 100%; Chicken: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Mouse: 100%; Rabbit: 100%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: androgen receptor N-terminal domain transactivating protein-1, ANT-1, bB152O15.1, C20orf14, chromosome 20 open reading frame 14, hPrp6, p102 U5 small nuclear ribonucleoprotein particle-binding protein, pre-mRNA-processing factor 6, Prp6, PRP6 homolog, PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae), PRP6 pre-mRNA processing factor 6 homolog (yeast), putative mitochondrial outer membrane protein import receptor, TOM, U5 snRNP-associated 102 kDa protein, U5-102 kDa protein, U5-102K
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 24148
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG