missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Protein Kinase A regulatory subunit I alpha Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35902-100ul
This item is not returnable.
View return policy
Description
Protein Kinase A regulatory subunit I alpha Polyclonal antibody specifically detects Protein Kinase A regulatory subunit I alpha in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence
Specifications
| Protein Kinase A regulatory subunit I alpha | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| cAMP-dependent protein kinase regulatory subunit RIalpha, cAMP-dependent protein kinase type I-alpha regulatory chain, cAMP-dependent protein kinase type I-alpha regulatory subunit, CAR, CNC, CNC1, MGC17251, PKA R1 alpha, PKA1, PKR1, PPNAD1, PRKAR1, protein kinase A type 1a regulatory subunit, protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specificextinguisher 1), Tissue-specific extinguisher 1, TSE1DKFZp779L0468 | |
| A synthetic peptide corresponding to a sequence within amino acids 300-386 of human Protein Kinase A regulatory subunit I alpha (NP_002725.1).,, Sequence:, AAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLSV | |
| 100 μL | |
| Cancer | |
| 5573 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction