Protein Kinase A regulatory subunit I alpha Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
30229553	Novus Biologicals NBP3-35902-100ul	100 μL
30228177	Novus Biologicals NBP3-35902-20ul	20 μL

Description

Protein Kinase A regulatory subunit I alpha Polyclonal antibody specifically detects Protein Kinase A regulatory subunit I alpha in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence

Specifications

• Antigen: Protein Kinase A regulatory subunit I alpha
• Applications: ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
• Conjugate: Unconjugated
• Host Species: Rabbit
• Research Discipline: Cancer
• Formulation: PBS (pH 7.3), 50% glycerol
• Gene ID (Entrez): 5573
• Isotype: IgG
• Purification Method: Affinity purified

• Dilution: Western Blot 1:500 - 1:2000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200
• Classification: Polyclonal
• Form: Purified
• Regulatory Status: RUO
• Target Species: Human, Mouse, Rat
• Gene Alias: cAMP-dependent protein kinase regulatory subunit RIalpha, cAMP-dependent protein kinase type I-alpha regulatory chain, cAMP-dependent protein kinase type I-alpha regulatory subunit, CAR, CNC, CNC1, MGC17251, PKA R1 alpha, PKA1, PKR1, PPNAD1, PRKAR1, protein kinase A type 1a regulatory subunit, protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specificextinguisher 1), Tissue-specific extinguisher 1, TSE1DKFZp779L0468
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-386 of human Protein Kinase A regulatory subunit I alpha (NP_002725.1).,, Sequence:, AAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLSV
• Primary or Secondary: Primary
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.