missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Proteasome 20S alpha 5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£305.00 - £443.00
Specifications
| Antigen | Proteasome 20S alpha 5 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:2500 - 1:5000 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18415741
|
Novus Biologicals
NBP1-86838-25ul |
25 μL |
£305.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18273417
|
Novus Biologicals
NBP1-86838 |
0.1 mL |
£443.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Proteasome 20S alpha 5 Polyclonal specifically detects Proteasome 20S alpha 5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Proteasome 20S alpha 5 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| EC 3.4.25.1, FLJ42315, macropain subunit zeta, Macropain zeta chain, MGC117302, MGC125802, MGC125803, MGC125804, Multicatalytic endopeptidase complex zeta chain, proteasome (prosome, macropain) subunit, alpha type, 5, proteasome alpha 5 subunit, proteasome component 5, proteasome subunit alpha type-5, proteasome subunit zeta, Proteasome zeta chain, PSC5, ZETA | |
| PSMA5 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| Polyclonal | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 5686 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:ARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title