missing translation for 'onlineSavingsMsg'
Learn More

Proteasome 20S alpha 5 Antibody, Novus Biologicals™

Product Code. 18415741 Shop All Bio Techne Products
missing translation for 'changeView'
missing translation for 'orderingAttributeHoverText'
Quantity:
0.1 mL
25 μL
missing translation for 'unitSize'
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18415741 25 μL 25µL
18273417 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 missing translation for 'options'
This item is not returnable. View return policy
Product Code. 18415741 missing translation for 'mfr' Novus Biologicals missing translation for 'supplierNo' NBP18683825ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

Proteasome 20S alpha 5 Polyclonal specifically detects Proteasome 20S alpha 5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Proteasome 20S alpha 5
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:2500 - 1:5000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias EC 3.4.25.1, FLJ42315, macropain subunit zeta, Macropain zeta chain, MGC117302, MGC125802, MGC125803, MGC125804, Multicatalytic endopeptidase complex zeta chain, proteasome (prosome, macropain) subunit, alpha type, 5, proteasome alpha 5 subunit, proteasome component 5, proteasome subunit alpha type-5, proteasome subunit zeta, Proteasome zeta chain, PSC5, ZETA
Gene Symbols PSMA5
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:ARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Core ESC Like Genes, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 5686
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.