missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Prolyl Oligopeptidase/PREP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | Prolyl Oligopeptidase/PREP |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Prolyl Oligopeptidase/PREP Polyclonal specifically detects Prolyl Oligopeptidase/PREP in Human samples. It is validated for Western Blot.Specifications
| Prolyl Oligopeptidase/PREP | |
| Polyclonal | |
| Rabbit | |
| P48147 | |
| 5550 | |
| Synthetic peptides corresponding to PREP(prolyl endopeptidase) The peptide sequence was selected from the middle region of PREP. Peptide sequence LHSLKFIATLQYIVGRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDM. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| dJ355L5.1 (prolyl endopeptidase), EC 3.4.21.26, MGC16060, PE, PEP, Post-proline cleaving enzyme, prolyl endopeptidase, prolyl oligopeptidase | |
| PREP | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title