Prolyl Oligopeptidase/PREP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-56842

Product Code. 18276852

Description

Prolyl Oligopeptidase/PREP Polyclonal specifically detects Prolyl Oligopeptidase/PREP in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Prolyl Oligopeptidase/PREP
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: dJ355L5.1 (prolyl endopeptidase), EC 3.4.21.26, MGC16060, PE, PEP, Post-proline cleaving enzyme, prolyl endopeptidase, prolyl oligopeptidase
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5550
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P48147
• Gene Symbols: PREP
• Immunogen: Synthetic peptides corresponding to PREP(prolyl endopeptidase) The peptide sequence was selected from the middle region of PREP. Peptide sequence LHSLKFIATLQYIVGRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDM.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Xenopus: 100%; Bovine: 100%; Chicken: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG