missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PRDM15 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-58475
This item is not returnable.
View return policy
Description
PRDM15 Polyclonal specifically detects PRDM15 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| PRDM15 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| C21orf83, chromosome 21 open reading frame 83, PFM15, PR domain containing 15, PR domain zinc finger protein 15, PR domain-containing protein 15, Zinc finger protein 298, ZNF298 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 63977 | |
| Human | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| PRDM15 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DKPMLKQAGSGVHAAGTPENSAPVESEPSQWACKVCSATFLELQLLNEHLLGHLEQAKSLPPGSQSEAAAPEKEQD | |
| 100 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction