missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PRAF1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | PRAF1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PRAF1 Polyclonal specifically detects PRAF1 in Human, Mouse samples. It is validated for Western Blot.Specifications
| PRAF1 | |
| Polyclonal | |
| Rabbit | |
| Q9GZS1-2 | |
| 64425 | |
| Synthetic peptides corresponding to POLR1E (polymerase (RNA) I polypeptide E, 53kDa) The peptide sequence was selected from the N terminal of POLR1E)(50ug). Peptide sequence SPGNMRFTLYENKDSTNPRKRNQRILAAETDRLSYVGNNFGTGALKCNTL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DNA-directed RNA polymerase I subunit E, DNA-directed RNA polymerase I subunit RPA49, FLJ13390, FLJ13970, FLJ43482, PAF53RNA polymerase I-associated factor 1, polymerase (RNA) I associated factor 1, polymerase (RNA) I polypeptide E, 53kDa, PRAF1, RNA polymerase I associated factor 53, RNA polymerase I subunit A49, RNA polymerase I-associated factor 53, RP11-405L18.3 | |
| POLR1E | |
| IgG | |
| This product is specific to Subunit or Isoform: RPA49. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title