PPP2R5E Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-79638

Product Code. 18279015

Description

PPP2R5E Polyclonal specifically detects PPP2R5E in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PPP2R5E
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: epsilon isoform of regulatory subunit B56, protein phosphatase 2A, PP2A B subunit isoform B56-epsilon, PP2A B subunit isoform B'-epsilon, PP2A B subunit isoform PR61-epsilon, PP2A B subunit isoform R5-epsilon, PP2A, B subunit, B' epsilon, PP2A, B subunit, B56 epsilon, PP2A, B subunit, PR61 epsilon, PP2A, B subunit, R5 epsilon, protein phosphatase 2, regulatory subunit B (B56), epsilon isoform, protein phosphatase 2, regulatory subunit B', epsilon isoform, serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, epsilon, serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilonisoform
• Host Species: Rabbit
• Molecular Weight of Antigen: 55 kDa
• Quantity: 100 μL
• Research Discipline: Wnt Signaling Pathway
• Gene ID (Entrez): 5529
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_006237
• Gene Symbols: PPP2R5E
• Immunogen: Synthetic peptide directed towards the N terminal of human PPP2R5EThe immunogen for this antibody is PPP2R5E. Peptide sequence QFRSQGKPIELTPLPLLKDVPSSEQPELFLKKLQQCCVIFDFMDTLSDLK.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.