missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PPP2R5E Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | PPP2R5E |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PPP2R5E Polyclonal specifically detects PPP2R5E in Human samples. It is validated for Western Blot.Specifications
| PPP2R5E | |
| Polyclonal | |
| Rabbit | |
| Wnt Signaling Pathway | |
| epsilon isoform of regulatory subunit B56, protein phosphatase 2A, PP2A B subunit isoform B56-epsilon, PP2A B subunit isoform B'-epsilon, PP2A B subunit isoform PR61-epsilon, PP2A B subunit isoform R5-epsilon, PP2A, B subunit, B' epsilon, PP2A, B subunit, B56 epsilon, PP2A, B subunit, PR61 epsilon, PP2A, B subunit, R5 epsilon, protein phosphatase 2, regulatory subunit B (B56), epsilon isoform, protein phosphatase 2, regulatory subunit B', epsilon isoform, serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, epsilon, serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilonisoform | |
| PPP2R5E | |
| IgG | |
| 55 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_006237 | |
| 5529 | |
| Synthetic peptide directed towards the N terminal of human PPP2R5EThe immunogen for this antibody is PPP2R5E. Peptide sequence QFRSQGKPIELTPLPLLKDVPSSEQPELFLKKLQQCCVIFDFMDTLSDLK. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title