missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PPM1M Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | PPM1M |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PPM1M Polyclonal specifically detects PPM1M in Human samples. It is validated for Western Blot.Specifications
| PPM1M | |
| Polyclonal | |
| Rabbit | |
| Protein Phosphatase | |
| FLJ32332, PP2CEEC 3.1.3.16, PP2Ceta, PP2C-eta, PPM1E, protein phosphatase 1M, protein phosphatase 1M (PP2C domain containing), protein phosphatase 2C eta, protein phosphatase 2C eta-2, Protein phosphatase 2C isoform eta, protein phosphatase, Mg2+/Mn2+ dependent, 1M | |
| PPM1M | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q96MI6-4 | |
| 132160 | |
| Synthetic peptides corresponding to PPM1M(protein phosphatase 1M (PP2C domain containing)) The peptide sequence was selected from the middle region of PPM1M. Peptide sequence RRLKGDDLGQKVLFRDHHMSGWSYKRVEKSDLKYPLIHGQGRQARLLGTL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title