missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PPM1M Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-56635
This item is not returnable.
View return policy
Description
PPM1M Polyclonal specifically detects PPM1M in Human samples. It is validated for Western Blot.
Specifications
| PPM1M | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| FLJ32332, PP2CEEC 3.1.3.16, PP2Ceta, PP2C-eta, PPM1E, protein phosphatase 1M, protein phosphatase 1M (PP2C domain containing), protein phosphatase 2C eta, protein phosphatase 2C eta-2, Protein phosphatase 2C isoform eta, protein phosphatase, Mg2+/Mn2+ dependent, 1M | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Expected identity based on immunogen sequence: Guinea pig: 100%; Human: 100%; Mouse: 100%; Bovine: 92%; Canine: 92%; Equine: 92%; Pig: 92%; Rabbit: 92%; Chicken: 84%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q96MI6-4 | |
| PPM1M | |
| Synthetic peptides corresponding to PPM1M(protein phosphatase 1M (PP2C domain containing)) The peptide sequence was selected from the middle region of PPM1M. Peptide sequence RRLKGDDLGQKVLFRDHHMSGWSYKRVEKSDLKYPLIHGQGRQARLLGTL. | |
| 100 μL | |
| Protein Phosphatase | |
| 132160 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction