missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PPIL5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | PPIL5 |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18672338
|
Novus Biologicals
NBP2-49457-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18603629
|
Novus Biologicals
NBP2-49457 |
0.1 mL |
£513.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
PPIL5 Polyclonal antibody specifically detects PPIL5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Spécification
| PPIL5 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| 4-1BBlrr, cyclophilin-like 5,4-1BB-mediated-signaling molecule, leucine rich repeat protein 1, LRR-1LRR-repeat protein 1, MGC20689,4-1BBLRR, peptidylprolyl isomerase (cyclophilin)-like 5,4-1BB-mediated signaling molecule, Peptidylprolyl isomerase-like 5, PPIL5 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GSHIIPFHLCQDLDTAKICVCGRFCLNSFIQGTTTMNLHSVAHTVVLVDNLGGTEAPIISYFCSLGCYVNSSDM | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2), 40% Glycerol | |
| 122769 | |
| IgG | |
| Immunogen affinity purified |
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit