PPIL5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-49457-25ul

Product Code. 18672338

Description

PPIL5 Polyclonal antibody specifically detects PPIL5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: PPIL5
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: 4-1BBlrr, cyclophilin-like 5,4-1BB-mediated-signaling molecule, leucine rich repeat protein 1, LRR-1LRR-repeat protein 1, MGC20689,4-1BBLRR, peptidylprolyl isomerase (cyclophilin)-like 5,4-1BB-mediated signaling molecule, Peptidylprolyl isomerase-like 5, PPIL5
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GSHIIPFHLCQDLDTAKICVCGRFCLNSFIQGTTTMNLHSVAHTVVLVDNLGGTEAPIISYFCSLGCYVNSSDM
• Quantity: 25 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 122769
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG