PP14/Glycodelin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18424991	Novus Biologicals NBP1-89782-25ul	25 μL
18245588	Novus Biologicals NBP1-89782	0.1 mL

Description

PP14/Glycodelin Polyclonal specifically detects PP14/Glycodelin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PP14/Glycodelin
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Developmental Biology
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 5047
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:NYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQME
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: alpha uterine protein, GdF, GdS, glycodelin, glycodelin-A, glycodelin-F, glycodelin-S, MGC138509, MGC142288, PEP, Placental protein 14, PP14 protein (placental protein 14), PP14GDPAEGGdA, pregnancy-associated endometrial a, Pregnancy-associated endometrial alpha-2 globulin, pregnancy-associated endometrial alpha-2-globulin, progestagen-associated endometrial protein (placental protein 14, progestagen-associated endometrial proteinPEG, Progesterone-associated endometrial protein
• Gene Symbols: PAEP
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only