missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PP14/Glycodelin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-89782-25ul
This item is not returnable.
View return policy
Description
PP14/Glycodelin Polyclonal specifically detects PP14/Glycodelin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| PP14/Glycodelin | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:20-1:50 | |
| alpha uterine protein, GdF, GdS, glycodelin, glycodelin-A, glycodelin-F, glycodelin-S, MGC138509, MGC142288, PEP, Placental protein 14, PP14 protein (placental protein 14), PP14GDPAEGGdA, pregnancy-associated endometrial a, Pregnancy-associated endometrial alpha-2 globulin, pregnancy-associated endometrial alpha-2-globulin, progestagen-associated endometrial protein (placental protein 14, progestagen-associated endometrial proteinPEG, Progesterone-associated endometrial protein | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| PAEP | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:NYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQME | |
| 25 μL | |
| Developmental Biology | |
| 5047 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction