missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Polypeptide GalNac Transferase 7/GALNT7 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£359.00
Specifications
| Antigen | Polypeptide GalNac Transferase 7/GALNT7 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Polypeptide GalNac Transferase 7/GALNT7 Polyclonal specifically detects Polypeptide GalNac Transferase 7/GALNT7 in Human samples. It is validated for Western Blot.Specifications
| Polypeptide GalNac Transferase 7/GALNT7 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| EC 2.4.1, EC 2.4.1.-, EC 2.4.1.37, EC 2.4.1.41, GalNAcT7, GalNAc-T7, N-acetylgalactosaminyltransferase 7, Polypeptide GalNAc transferase 7, polypeptide N-acetylgalactosaminyltransferase 7, pp-GaNTase 7, Protein-UDP acetylgalactosaminyltransferase 7, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 7, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 7 (GalNAc-T7) | |
| The immunogen is a synthetic peptide directed towards the N-terminal region of Human Polypeptide GalNac Transferase 7/GALNT7. Peptide sequence SPLSRMREDRDVNDPMPNRGGNGLAPGEDRFKPVVPWPHVEGVEVDLESI | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 51809 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title