missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Polypeptide GalNac Transferase 7/GALNT7 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Shop All Bio Techne ProductsDescription
Polypeptide GalNac Transferase 7/GALNT7 Polyclonal specifically detects Polypeptide GalNac Transferase 7/GALNT7 in Human samples. It is validated for Western Blot.
Specifications
Specifications
| Antigen | Polypeptide GalNac Transferase 7/GALNT7 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | EC 2.4.1, EC 2.4.1.-, EC 2.4.1.37, EC 2.4.1.41, GalNAcT7, GalNAc-T7, N-acetylgalactosaminyltransferase 7, Polypeptide GalNAc transferase 7, polypeptide N-acetylgalactosaminyltransferase 7, pp-GaNTase 7, Protein-UDP acetylgalactosaminyltransferase 7, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 7, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 7 (GalNAc-T7) |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human Polypeptide GalNac Transferase 7/GALNT7. Peptide sequence SPLSRMREDRDVNDPMPNRGGNGLAPGEDRFKPVVPWPHVEGVEVDLESI |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?