missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Polypeptide GalNac Transferase 3/GALNT3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | Polypeptide GalNac Transferase 3/GALNT3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Polypeptide GalNac Transferase 3/GALNT3 Polyclonal specifically detects Polypeptide GalNac Transferase 3/GALNT3 in Rat samples. It is validated for Western Blot.Specifications
| Polypeptide GalNac Transferase 3/GALNT3 | |
| Polyclonal | |
| Rabbit | |
| Q3T1J4 | |
| 2591 | |
| Synthetic peptides corresponding to the N terminal of Galnt3. Immunizing peptide sequence PERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKPFKITHLSPEEQKEKE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 2.4.1.41, GalNAc transferase 3, GalNAc-T3DKFZp686C10199, HFTCMGC61909, HHSPolypeptide GalNAc transferase 3, polypeptide GalNAc-transferase T3, polypeptide N-acetylgalactosaminyltransferase 3, pp-GaNTase 3, Protein-UDP acetylgalactosaminyltransferase 3, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 3, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 3 (GalNAc-T3) | |
| GALNT3 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title